SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P0C591 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P0C591
Domain Number 1 Region: 36-203
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.81e-42
Family Dual specificity phosphatase-like 0.0000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P0C591
Sequence length 219
Comment (sp|P0C591|DUPD1_BOVIN) Dual specificity phosphatase DUPD1 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=DUPD1; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MTSGESKTGLKNVYPSAKKLLPKVEEGEAEDYCTPGAFELERLFWKGSPQYTHVNEVWPK
LYIGDETTALDRYGLQKAGFTHVLNAAHGRWNVDTGPDYYRDMAIEYHGVEADDLPSFDL
SVFFYPAAAFIDAALRYDHNKILVHCVMGRSRSATLVLAYLMIHRNMTLVDAIQQVAKNR
CVLPNRGFLKQLRELDRQLVQQRRQAQQGEDAEKCEQEP
Download sequence
Identical sequences P0C591
9913.ENSBTAP00000003800 ENSBTAP00000003800 ENSBTAP00000003800 XP_005226533.1.76553 XP_019809368.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]