SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P10895 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P10895
Domain Number 1 Region: 299-617
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 1.01e-128
Family Mammalian PLC 0.0000000000488
Further Details:      
 
Domain Number 2 Region: 139-295
Classification Level Classification E-value
Superfamily EF-hand 6.08e-47
Family EF-hand modules in multidomain proteins 0.000000698
Further Details:      
 
Domain Number 3 Region: 629-754
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.49e-31
Family PLC-like (P variant) 0.00000388
Further Details:      
 
Domain Number 4 Region: 15-129
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-28
Family Pleckstrin-homology domain (PH domain) 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P10895
Sequence length 756
Comment (sp|P10895|PLCD1_BOVIN) Phospholipase C-delta-1 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PLCD1; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MDSGRDFLTLHGLQDDKDLQALLKGGQLLKVKSNSWRRERFYKLQEDCKTIWQESRKVMR
TPESQLFSIEDIQEVRMGHRTEGLEKFARDVPENRCFSIVFKDQRNTLDLIAPSPADAQH
WVQGLGKIIHHSGSMDQQQKLRHWIHSCLRKADKNKDNKMSFKELQNFLKELNIQVDDSY
ARKIFKECDHSQTDSLEDEEIETFYKILTQRKEIDRTFEEATGSKETLSVDQLVTFLQHQ
QREEEAGPALALSLIERYEPSETAKAQRQMTKDGFLMYLLSADGSAFDLAHRRVYQDMDQ
PLSHYLVSSSHNTYLLEDQLTGPSSTEAYIRALCKGCRCLELDCWDGPNQEPIIYHGYTF
TSKILFCDVVRAIRDYAFKASPYPVILSLENHCSLEQQRVMARHLRTLLGPMLLDRPLDG
VVTSLPSPEQLRGKILLKGKKLGGLFPPGGEGGPEATVVSDEDEAAEMEDEAVRSQVQHK
SKEDKLRLAKELSDMVIYCKSVHFRGFPSSGTSGQAFYEMSSFSENRALRLLQESGNSFV
RHNVNHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNFQTPGSEMDVYQGRFLDNGACG
YVLKPAFLRDPNSTFNSRALAHGPWWTPKRLNVRVISGQQLPKVNKNKNSIVDPKVTVEI
HGVSRDVASRQTAVVTNNGFNPWWDTELEFEVAVPELALVRFVVEDYDASSKNDFIGQST
IPLKSLKQGYRHIHLLSKNGDQHPSATLFVKVALQD
Download sequence
Identical sequences P10895
ENSBTAP00000049395 ENSBTAP00000049395 9913.ENSBTAP00000049395 NP_001075045.1.59421 NP_001075045.1.76553 XP_019840557.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]