SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P12973 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P12973
Domain Number 1 Region: 3-249
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 7.85e-127
Family Methyl-coenzyme M reductase gamma chain 0.0000000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P12973
Sequence length 249
Comment (sp|P12973|MCRG_METFE) Coenzyme-B sulfoethylthiotransferase gamma OX=2180 OS=Methanothermus fervidus. GN=mcrG; OC=Methanothermaceae; Methanothermus.
Sequence
MAQFYPGSTKIAENRRKFMNPDAELEKLREISDEDVVRILGHRAPGEEYPSVHPPLEELD
EPEDPIKDIVEPTEGAKAGDRVRYVQFTDSVYFAPAQPYIRSRAYLWRYRGADAGTLSGR
QIIEARERDVEKIAKELIETEFFDPARTGIRGKSVHGHSLRLDENGMMFDMLRRQVYDEE
TGRVKMVKNQIGDEFDEPIDLGEPLDEETLKEKTTIYRIDNIPYREDKDLLEIVQRIHQL
RSEAGFSPE
Download sequence
Identical sequences E3GZ52 P12973
WP_013413862.1.12012 gi|312137009|ref|YP_004004346.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]