SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P12980 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P12980
Domain Number 1 Region: 151-216
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.88e-17
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P12980
Sequence length 280
Comment (sp|P12980|LYL1_HUMAN) Lymphoblastic leukemia-derived sequence 1 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=LYL1; OC=Catarrhini; Hominidae; Homo.
Sequence
MCPPQAQAEVGPTMTEKAEMVCAPSPAPAPPPKPASPGPPQVEEVGHRGGSSPPRLPPGV
PVISLGHSRPPGVAMPTTELGTLRPPLLQLSTLGTAPPTLALHYHPHPFLNSVYIGPAGP
FSIFPSSRLKRRPSHCELDLAEGHQPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTH
PPDRKLSKNEVLRLAMKYIGFLVRLLRDQAAALAAGPTPPGPRKRPVHRVPDDGARRGSG
RRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR
Download sequence
Identical sequences P12980
ENSP00000264824 gi|34147558|ref|NP_005574.2| HR6403 ENSP00000264824 ENSP00000264824 9606.ENSP00000264824 NP_005574.2.87134 NP_005574.2.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]