SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P13439 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P13439
Domain Number 1 Region: 236-477
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.38e-56
Family Decarboxylase 0.00000054
Further Details:      
 
Domain Number 2 Region: 10-205
Classification Level Classification E-value
Superfamily PRTase-like 2.96e-43
Family Phosphoribosyltransferases (PRTases) 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P13439
Sequence length 481
Comment (sp|P13439|UMPS_MOUSE) OMPdecase KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Umps; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MEVASQALGPLVTELYDVQAFKFGSFVLKSGLSSPVYIDLRGIVSRPRLLSQVADILFQT
AKNAGISFDSVCGVPYTALPLATVICSANHIPMLIRRKETKDYGTKRLVEGEINPGQTCL
VIEDVVTSGASVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLQAQGIRLHAVCTLSQML
EILQQQEKIDADMVGRVKRFIQENVFSAANHNGLPPPEKKACKELSFGARAELPGTHPLA
SKLLRLMQKKETNLCLSADVSEARELLQLADALGPSICMLKTHVDILNDFTLDVMEELTA
LAKRHEFLIFEDRKFADIGNTVKKQYESGTFKIASWADIVNAHVVPGSGVVKGLQEVGLP
LHRACLLIAEMSSAGSLATGNYTKAAVGMAEEHCEFVIGFISGSRVSMKPEFLHLTPGVQ
LETGGDHLGQQYNSPQEVIGKRGSDVIIVGRGILAAANRLEAAEMYRKAAWEAYLSRLAV
Q
Download sequence
Identical sequences P13439 Q544K9
ENSMUSP00000023510 NP_033497.1.92730 ENSMUSP00000023510 399847 ENSMUSP00000023510 10090.ENSMUSP00000023510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]