SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P15533 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P15533
Domain Number 1 Region: 295-494
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-37
Family SPRY domain 0.00035
Further Details:      
 
Domain Number 2 Region: 3-89
Classification Level Classification E-value
Superfamily RING/U-box 1.94e-27
Family RING finger domain, C3HC4 0.0048
Further Details:      
 
Domain Number 3 Region: 88-150
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.43e-17
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Domain Number 4 Region: 119-241
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0000379
Family Apolipoprotein A-I 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P15533
Sequence length 496
Comment (sp|P15533|TR30A_MOUSE) Tripartite motif-containing protein 30 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Trim30a; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MASSVLEMIKEEVTCPICLELLKEPVSADCNHSFCRACITLNYESNRNTDGKGNCPVCRV
PYPFGNLRPNLHVANIVERLKGFKSIPEEEQKVNICAQHGEKLRLFCRKDMMVICWLCER
SQEHRGHQTALIEEVDQEYKEKLQGALWKLMKKAKICDEWQDDLQLQRVDWENQIQINVE
NVQRQFKGLRDLLDSKENEELQKLKKEKKEVMEKLEESENELEDQTELVRDLISDVEHHL
ELSTLEMLQGANCVLRRSQSLSLQQPQTVPQKRKRTFQAPDLKGMLQVYQGLMDIQQYWV
HMTLHARNNAVIAINKEKRQIQYRSYNTVPVSEIYHLGVLGYPALSSGKHYWEVDISRSD
AWLLGLNDGKCAQPQLHSKEEMGIKKNLHSQIKQNVLFQPKCGYWVIGMKNPSVYKAFDE
CSITHNSSILVISLPDRPSRVGVFLDRKAGTLSFYDVSNCGALIYRFYDPAFPVEVYPYF
NPMKCSEPMTICGPPS
Download sequence
Identical sequences P15533
ENSMUSP00000076189 ENSMUSP00000076189 NP_033125.2.92730 XP_006507534.1.92730 10090.ENSMUSP00000076189 ENSMUSP00000076189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]