SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P17028 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P17028
Domain Number 1 Region: 46-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.66e-39
Family SCAN domain 0.0000575
Further Details:      
 
Domain Number 2 Region: 287-342
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.54e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 249-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-18
Family Classic zinc finger, C2H2 0.0015
Further Details:      
 
Domain Number 4 Region: 333-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000221
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P17028
Sequence length 368
Comment (sp|P17028|ZNF24_HUMAN) Zinc finger protein KOX17 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF24; OC=Catarrhini; Hominidae; Homo.
Sequence
MSAQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLPDPEIFRQRFRQFGY
QDSPGPREAVSQLRELCRLWLRPETHTKEQILELVVLEQFVAILPKELQTWVRDHHPENG
EEAVTVLEDLESELDDPGQPVSLRRRKREVLVEDMVSQEEAQGLPSSELDAVENQLKWAS
WELHSLRHCDDDGRTENGALAPKQELPSALESHEVPGTLNMGVPQIFKYGETCFPKGRFE
RKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRV
HTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQCGKSYSQSSNLFRHQRRHNAE
KLLNVVKV
Download sequence
Identical sequences P17028
ENSP00000261332 9606.ENSP00000261332 ENSP00000261332 ENSP00000382015 ENSP00000261332 ENSP00000382015 gi|190610012|ref|NP_008896.2| NP_008896.2.87134 NP_008896.2.92137 XP_005258398.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]