SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P17214 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P17214
Domain Number 1 Region: 59-583
Classification Level Classification E-value
Superfamily TPR-like 5.69e-53
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P17214
Sequence length 699
Comment (sp|P17214|EST1_YEAST) Ever shorter telomeres protein 1 KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=EST1; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MDNEEVNEECMRLFFKNARAHLDKHLTSRLTCDENAYITFRCFLDGIHRKSTRFLEELLL
KQENMYHNNNYERINDSVIPLVLKLLWLQIHEPTLQWFEHWFHDIMRLSNRRKFRVFRIF
QKKMIQFFKITHRYYYDIIEHLCAKYDMNSVISNALFAKLNLMQYTDGLSTHEKIILNTS
NPLTFSIVISLQRCVINLGSTHFYKTLLNKPSNKPKSVEGFEKSIRYLNIASLYLPAVGD
TYFQRAKIYLITGKFSLYFFELVRGALVRIPSKCALNNLKDFILTPDFPERRRLMKKLAI
LVSKDLKGEKSFFEGQIVLQFLSIVEHTLVPQSWNASRASNCWLLKEHLQMAALKYHSGN
INVILENLAATMGSFDLMFTTRKSKEQKNKLKYADLSERQVFFLDLSFDFIANIIDVVIK
PSWQKNMEDFRYLAIIRLLMCWIKSYRSILQYTHRHRKFCTSFALLLNDLINSPLNCSGN
IYSHRPKRSYLFREDIIFREFSCINFALTDFNDDYVYDSPDMINNIIGCPTLTKVLSPKE
ECVLRIRSIIFSGMKFLEKNDTGVIWNASKYKFDLISPNIKIKRQIALSEISSKINVKTQ
QERVVSSRKVEAKRDEQQRKRAGKIAVTELEKQFANVRRTKKLSPLPEKDGVSSELVKHA
ASRGRKTITGPLSSDFLSYPDEAIDADEDITVQVPDTPT
Download sequence
Identical sequences N1P6W9 P17214
YLR233c 4932.YLR233C YLR233C YLR233C YLR233C YLR233C NP_013334.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]