SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P18153 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P18153
Domain Number 1 Region: 164-272
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 4.71e-18
Family Insect pheromone/odorant-binding proteins 0.0014
Further Details:      
 
Domain Number 2 Region: 21-100
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000877
Family Insect pheromone/odorant-binding proteins 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P18153
Sequence length 321
Comment (sp|P18153|ALL2_AEDAE) Protein D7 KW=Complete proteome; Reference proteome OX=7159 OS=Aedes aegypti (Yellowfever mosquito) (Culex aegypti). GN=D7; OC=Culicidae; Culicinae; Aedini; Aedes; Stegomyia.
Sequence
MKLPLLLAIVTTFSVVASTGPFDPEEMLFTFTRCMEDNLEDGPNRLPMLAKWKEWINEPV
DSPATQCFGKCVLVRTGLYDPVAQKFDASVIQEQFKAYPSLGEKSKVEAYANAVQQLPST
NNDCAAVFKAYDPVHKAHKDTSKNLFHGNKELTKGLYEKLGKDIRQKKQSYFEFCENKYY
PAGSDKRQQLCKIRQYTVLDDALFKEHTDCVMKGIRYITKNNELDAEEVKRDFMQVNKDT
KALEKVLNDCKSKEPSNAGEKSWHYYKCLVESSVKDDFKEAFDYREVRSQIYAFNLPKKQ
VYSKPAVQSQVMEIDGKQCPQ
Download sequence
Identical sequences P18153
AAEL006424-PA XP_001657779.1.48696 XP_021712859.1.48696 7159.AAEL006424-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]