SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P20111 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P20111
Domain Number 1 Region: 21-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.83e-86
Family Calponin-homology domain, CH-domain 0.0000277
Further Details:      
 
Domain Number 2 Region: 277-399
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-34
Family Spectrin repeat 0.000000247
Further Details:      
 
Domain Number 3 Region: 513-634
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-31
Family Spectrin repeat 0.00000084
Further Details:      
 
Domain Number 4 Region: 400-508
Classification Level Classification E-value
Superfamily Spectrin repeat 7.46e-24
Family Spectrin repeat 0.00000107
Further Details:      
 
Domain Number 5 Region: 742-870
Classification Level Classification E-value
Superfamily EF-hand 2.3e-22
Family EF-hand modules in multidomain proteins 0.007
Further Details:      
 
Domain Number 6 Region: 638-749
Classification Level Classification E-value
Superfamily Spectrin repeat 6.05e-22
Family Spectrin repeat 0.00000089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P20111
Sequence length 897
Comment (sp|P20111|ACTN2_CHICK) F-actin cross-linking protein KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=ACTN2; OC=Phasianidae; Phasianinae; Gallus.
Sequence
MNSMNQIETNMQYTYNYEEDEYMTQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGT
QIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSI
GAEEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFH
LSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNT
PKPDERAIMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENERLMEEYERLASELLEWI
RRTIPWLENRTPEKTMQAMQKKLEDFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNR
PAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERLEHLAEKFRQKASTHEQWA
YGKEQILLQKDYESASLTEVRAMLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAA
SVNDRCQKICDQWDSLGTLTQKRREALERTEKLLETIDQLHLEFAKRAAPFNNWMEGAME
DLQDMFIVHSIEEIQSLISAHDQFKATLPEADGERQAILSIQNEVEKVIQSYSMRISASN
PYSTVTVEEIRTKWEKVKQLVPQRDQSLQEELARQHANERLRRQFAAQANVIGPWIQTKM
EEIARSSIEMTGPLEDQMNQLKQYEQNIINYKHNIDKLEGDHQLIQEALVFDNKHTNYTM
EHIRVGWELLLTTIARTINEVETQILTRDAKGITQEQMNDFRASFNHFDRRKNGLMDHDD
FRACLISMGYDLGEAEFARIMSLVDPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRI
LASDKPYILADELRRELPPEQAQYCIKRMPQYTGPGSVPGALDYTSFSSALYGESDL
Download sequence
Identical sequences P20111 R9PXQ0
ENSGALP00000023309 9031.ENSGALP00000023309 NP_990654.1.86415 XP_003204057.2.16129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]