SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P21457 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P21457
Domain Number 1 Region: 9-175
Classification Level Classification E-value
Superfamily EF-hand 1.94e-56
Family Calmodulin-like 0.0000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P21457
Sequence length 202
Comment (sp|P21457|RECO_BOVIN) p26 KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=RCVRN; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MGNSKSGALSKEILEELQLNTKFTEEELSSWYQSFLKECPSGRITRQEFQTIYSKFFPEA
DPKAYAQHVFRSFDANSDGTLDFKEYVIALHMTSAGKTNQKLEWAFSLYDVDGNGTISKN
EVLEIVTAIFKMISPEDTKHLPEDENTPEKRAEKIWGFFGKKDDDKLTEKEFIEGTLANK
EILRLIQFEPQKVKEKLKEKKL
Download sequence
Identical sequences P21457
2i94A ENSBTAP00000034949 2i94_A NP_776590.1.59421 NP_776590.1.76553 ENSBTAP00000034949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]