SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P22448 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P22448
Domain Number 1 Region: 137-415
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-78
Family Nuclear receptor ligand-binding domain 0.00000000142
Further Details:      
 
Domain Number 2 Region: 84-163
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.17e-27
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P22448
Sequence length 455
Comment (sp|P22448|RARB_CHICK) Nuclear receptor subfamily 1 group B member 2 KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=RARB; OC=Phasianidae; Phasianinae; Gallus.
Sequence
MTTSSRTCPVPAVNGHMTHYPAAPYPLLFPPVIGGLSLPSLHGLQSHPPTSGCSTPSPAT
VETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNM
VYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEPTKQESTENYEM
TAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIV
EFAKRLPGFTSLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPMKVDKLQEPLLEALK
IYIRKRRPNKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGH
EPLTPTSNGNTAEHSPSISPSSVDNSSVSQSPMVQ
Download sequence
Identical sequences G3UUU2 P22448
ENSGALP00000036953 ENSMGAP00000011537 9031.ENSGALP00000036953 ENSGALP00000018407 NP_990657.1.86415 XP_010711169.1.16129 XP_015136799.1.86415 XP_015136800.1.86415 ENSMGAP00000019561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]