SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P22570 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P22570
Domain Number 1 Region: 139-362
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.42e-54
Family C-terminal domain of adrenodoxin reductase-like 0.00000000619
Further Details:      
 
Domain Number 2 Region: 37-198
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.71e-20
Family N-terminal domain of adrenodoxin reductase-like 0.00000597
Further Details:      
 
Domain Number 3 Region: 335-490
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.0000000541
Family N-terminal domain of adrenodoxin reductase-like 0.000000636
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P22570
Sequence length 491
Comment (sp|P22570|ADRO_HUMAN) Ferredoxin--NADP(+) reductase KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FDXR; OC=Catarrhini; Hominidae; Homo.
Sequence
MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKH
PQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVP
ELREAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAV
ILGQGNVALDVARILLTPPEHLERTDITKAALGVLRQSRVKTVWLVGRRGPLQVAFTIKE
LREMIQLPGARPILDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASAS
RAWGLRFFRSPQQVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTGDMEDLPCGLVLSSI
GYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQM
LLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLV
DPQEMLRLLGH
Download sequence
Identical sequences P22570 Q6GSK2
gi|111118981|ref|NP_077728.2| ENSP00000293195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]