SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P23340 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P23340
Domain Number 1 Region: 5-212,256-328
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.39e-73
Family beta-glycanases 0.0000000000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P23340
Sequence length 343
Comment (sp|P23340|GUNC_CLOSF) Endo-1,4-beta-glucanase C307 OX=1508 OS=Clostridium sp. (strain F1). GN=celC307; OC=Clostridium.
Sequence
MVSFKAGINLGGWISQYQVFSKEHFDTFITEKDIETIAEAGFDHVRLPFDYPIIESDDNV
GEYKEDGLSYIDRCLEWCKKYNLGLVLDMHHAPGYRFQDFKTSTLFEDPNQQKRFVDIWR
FLAKRYINEREHIAFELLNEVVEPDSTRWNKLMLECVKAIREIDSTRWLYIGGNNYNSPD
ELKNLADIDDDYIVYNFHFYNPFFFTHQKAHWSESAMAYNRTVKYPGQYEGIEEFVKNNP
KYSFMMELNNLKLNKELLRKDLKPAIEFREKKKCKLYCGEFGVIAIADLESRIKWHEDYI
SLLEEYDIGGAVWNYKKMDFEIYNEDRKPVSQELVNILARRKT
Download sequence
Identical sequences A3DJ77 P23340
203119.Cthe_2807 gi|125975289|ref|YP_001039199.1| gi|385777771|ref|YP_005686936.1| WP_003514472.1.19387 WP_003514472.1.20586 WP_003514472.1.31213 WP_003514472.1.55520 WP_003514472.1.60145 WP_003514472.1.6636 WP_003514472.1.6965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]