SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P26897 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P26897
Domain Number 1 Region: 119-179
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000125
Family Complement control module/SCR domain 0.0000912
Further Details:      
 
Domain Number 2 Region: 23-77
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000324
Family Complement control module/SCR domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P26897
Sequence length 267
Comment (sp|P26897|IL2RA_RAT) Interleukin-2 receptor subunit alpha KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Il2ra; OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MEPHLLMLGFLSFTIVPGCWAELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLNE
LVYMACLGNSWSNNCQCTSNSHDNSREQVTPQPEGQKEQQTTDTQKSTQSVYQENLAGHC
REPPPWRHEDTKRIYHFVEGQIVLYTCIQGYKALQRGPAISICKTVCGEIRWTHPQLTCV
DEKEHHQFLASEESQGSRNSFPESEASCPTPNTDFSQLTEATTTMETFVFTKEYQVAVAS
CIFLLLSILLLSGFTWQHRWRKSRRTI
Download sequence
Identical sequences P26897
ENSRNOP00000066383 NP_037295.1.100692 NP_037295.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]