SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P27177 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P27177
Domain Number 1 Region: 132-246
Classification Level Classification E-value
Superfamily Prion-like 2.09e-42
Family Prion-like 0.000000393
Further Details:      
 
Weak hits

Sequence:  P27177
Domain Number - Region: 41-108,161-195
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00068
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P27177
Sequence length 273
Comment (sp|P27177|PRIO_CHICK) PR-LP KW=Complete proteome; Reference proteome OX=9031 OS=Gallus gallus (Chicken). GN=PRNP; OC=Phasianidae; Phasianinae; Gallus.
Sequence
MARLLTTCCLLALLLAACTDVALSKKGKGKPSGGGWGAGSHRQPSYPRQPGYPHNPGYPH
NPGYPHNPGYPHNPGYPHNPGYPQNPGYPHNPGYPGWGQGYNPSSGGSYHNQKPWKPPKT
NFKHVAGAAAAGAVVGGLGGYAMGRVMSGMNYHFDSPDEYRWWSENSARYPNRVYYRDYS
SPVPQDVFVADCFNITVTEYSIGPAAKKNTSEAVAAANQTEVEMENKVVTKVIREMCVQQ
YREYRLASGIQLHPADTWLAVLLLLLTTLFAMH
Download sequence
Identical sequences P27177
ENSGALP00000040284 ENSGALP00000040285 9031.ENSGALP00000040285 NP_990796.2.86415 XP_015152786.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]