SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P28621 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P28621
Domain Number 1 Region: 37-373
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.27e-86
Family beta-glycanases 0.000000285
Further Details:      
 
Domain Number 2 Region: 382-439
Classification Level Classification E-value
Superfamily Type I dockerin domain 8.73e-16
Family Type I dockerin domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P28621
Sequence length 440
Comment (sp|P28621|GUNB_CLOC7) Endo-1,4-beta-xylanase KW=Complete proteome; Reference proteome OX=573061 OS=743B). GN=engB; OC=Clostridium.
Sequence
MNKRLSRGKISLLASVFVTTTFMGGVNVLASTAKTGIRDITSQQVVKEMKVGWNLGNTMD
ATGGETNWGNPLTTHAMIDKVKAAGFNTLRLPITWDGHIGAAPDYAIDATWMNRVEEIAN
YAFDNNMYVIINLHHEDGWLKPYYANEAEVKAKITKVWTQIANRFKDYGDYLIFETMNEP
RPVGAADEWSGGSYENRDMVNRYNLTAVNTIRATGGNNALRHIMVPTLAAAALSTTMNDY
IVPNNDSRVIVSLHMYSPYFFSADLTSQWTTATWGSDADKAALSADFDAVYNKFVKNGRA
VVIGEMGTINKNNLDSRVKHAEYYAKEATVRGITPIWWDNGYCVAGKEQTFGIFNRKNLT
WCCPEVMQAFIRGAGATQTQTSYSLGDVNKDGKVNAIDYAVLKSILLGTNTNVDLSVSDM
NKDGKVNALDLAVLKKMLLS
Download sequence
Identical sequences P28621
gi|302874037|ref|YP_003842670.1| WP_010076241.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]