SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P30204 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P30204
Domain Number 1 Region: 354-457
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P30204
Sequence length 458
Comment (sp|P30204|MSRE_MOUSE) Scavenger receptor type A KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Msr1; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MTKEMTENQRLCPHEQEDADCSSESVKFDARSMTASLPHSTKNGPSLQEKLKSFKAALIA
LYLLVFAVLIPVVGIVTAQLLNWEMKNCLVCSLNTSDTSQGPMEKENTSKVEMRFTIIME
HMKDMEERIESISNSKADLIDTERFQNFSMATDQRLNDILLQLNSLISSVQEHGNSLDAI
SKSLQSLNMTLLDVQLHTETLNVRVRESTAKQQEDISKLEERVYKVSAEVQSVKEEQAHV
EQEVKQEVRVLNNITNDLRLKDWEHSQTLKNITFIQGPPGPQGEKGDRGLTGQTGPPGAP
GIRGIPGVKGDRGQIGFPGGRGNPGAPGKPGRSGSPGPKGQKGEKGSVGGSTPLKTVRLV
GGSGAHEGRVEIFHQGQWGTICDDRWDIRAGQVVCRSLGYQEVLAVHKRAHFGQGTGPIW
LNEVMCFGRESSIENCKINQWGVLSCSHSEDAGVTCTS
Download sequence
Identical sequences P30204
ENSMUSP00000026021 ENSMUSP00000026021 ENSMUSP00000026021 NP_001106797.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]