SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P32599 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P32599
Domain Number 1 Region: 137-638
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.7e-169
Family Calponin-homology domain, CH-domain 0.0000000000013
Further Details:      
 
Domain Number 2 Region: 7-90,161-181
Classification Level Classification E-value
Superfamily EF-hand 0.0000000368
Family Calmodulin-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P32599
Sequence length 642
Comment (sp|P32599|FIMB_YEAST) ABP67 KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=SAC6; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MNIVKLQRKFPILTQEDLFSTIEKFRAIDLDDKGWVEKQQALEAVSKDGDATYDEARETL
KHVGVDASGRVELDDYVGLVAKLRESKTGAAPQTTFNVAPNSTPIVSTAATGLQHKGKGT
QAKIIVAGSQTGTTHTINEEERREFTKHINSVLAGDQDIGDLLPFPTDTFQLFDECRDGL
VLSKLINDSVPDTIDTRVLNWPKKGKELNNFQASENANIVINSAKAIGCVVVNVHSEDII
EGREHLILGLIWQIIRRGLLSKIDIKLHPELYRLLEDDETLEQFLRLPPEQILLRWFNYH
LKQANWNRRVTNFSKDVSDGENYTILLNQLDPALCSKAPLQTTDLMERAEQVLQNAEKLD
CRKYLTPSSLVAGNPKLNLAFVAHLFNTHPGLEPIQEEEKPEIEEFDAEGEREARVFTLW
LNSLDVDPPVISLFDDLKDGLILLQAYEKVMPGAVDFKHVNKRPASGAEISRFKALENTN
YAVDLGRAKGFSLVGIEGSDIVDGNKLLTLGLVWQLMRRNISITMKTLSSSGRDMSDSQI
LKWAQDQVTKGGKNSTIRSFKDQALSNAHFLLDVLNGIAPGYVDYDLVTPGNTEEERYAN
ARLAISIARKLGALIWLVPEDINEVRARLIITFIASLMTLNK
Download sequence
Identical sequences A0A0L8VT68 C8Z545 P32599
YDR129C YDR129C YDR129C YDR129C YDR129C YDR129C NP_010414.3.97178 4932.YDR129C YDR129C YDR129C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]