SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P33313 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P33313
Domain Number 1 Region: 81-211
Classification Level Classification E-value
Superfamily TPR-like 2.02e-25
Family Tetratricopeptide repeat (TPR) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P33313
Sequence length 385
Comment (sp|P33313|CNS1_YEAST) STI1 stress-inducible protein homolog KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=CNS1; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSSVNANGGYTKPQKYVPGPGDPELPPQLSEFKDKTSDEILKEMNRMPFFMTKLDETDGA
GGENVELEALKALAYEGEPHEIAENFKKQGNELYKAKRFKDARELYSKGLAVECEDKSIN
ESLYANRAACELELKNYRRCIEDCSKALTINPKNVKCYYRTSKAFFQLNKLEEAKSAATF
ANQRIDPENKSILNMLSVIDRKEQELKAKEEKQQREAQERENKKIMLESAMTLRNITNIK
THSPVELLNEGKIRLEDPMDFESQLIYPALIMYPTQDEFDFVGEVSELTTVQELVDLVLE
GPQERFKKEGKENFTPKKVLVFMETKAGGLIKAGKKLTFHDILKKESPDVPLFDNALKIY
IVPKVESEGWISKWDKQKALERRSV
Download sequence
Identical sequences A0A250WFS9 A6ZL97 N1P9I2 P33313
YBR155W YBR155W tr|A6ZL97|A6ZL97_YEAS7 YBR155W YBR155W YBR155W YBR155W YBR155W 4932.YBR155W NP_009713.1.97178 YBR155W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]