SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P34367 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P34367
Domain Number 1 Region: 1562-1669
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000222
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 2093-2213
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000307
Family Calmodulin-like 0.0083
Further Details:      
 
Domain Number 3 Region: 209-335
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000216
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 4 Region: 41-146
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000785
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 5 Region: 811-898
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000109
Family Spectrin repeat 0.0094
Further Details:      
 
Domain Number 6 Region: 1310-1431
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000216
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 7 Region: 747-834
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000916
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 8 Region: 1224-1361
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000993
Family Spectrin repeat 0.0035
Further Details:      
 
Weak hits

Sequence:  P34367
Domain Number - Region: 1112-1211
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0011
Family Spectrin repeat 0.02
Further Details:      
 
Domain Number - Region: 1874-1971
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0161
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number - Region: 1434-1489
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0504
Family Spectrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P34367
Sequence length 2236
Comment (sp|P34367|YLJ2_CAEEL) Uncharacterized protein C50C3.2 KW=Complete proteome; Reference proteome OX=6239 OS=Caenorhabditis elegans. GN=C50C3.2/C50C3.3; OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MKAIIHDDTVVREIEGQRVQVLQKFADFELKAINKRSSIIQSRQLQVYLRSAAEFKQVIE
SLIESSEAVVTSQCSESSIRGQKVIGRLQQEADGKHNNLPMLENEAARLLKEGHYASDEI
QKTFNNVLSRWEYLLKLLALKWRQLEKEIESIEFKNKCDSIVDWILKIKESDESGKEIFD
EIRKCSMVWNEISATFQQMLDPTATDTSNYEKVHETWSNFQEYIDSLHKKLSENERFQKF
VDNAEDLIKWMDDKEKEICEKYSKMDFEVMMKYRKTVEIEMKSVEQRIKDLKEQFVGMEN
DNLRNIPDPKNHVIDVEQRFESFQAFVQKWKTDIENSADADKLMKEAENICCWSSEKIED
LKIMATSDTPDCDEIIMWIETNNFDFNSWDNVVVQFLASSQELLNKQNNGNVKQEVERTT
ELYELAKRTMKTCNEFLEDRIQTINMEKLIFQTHQKAVILASFLQNHEESPEDMNAEDIE
KEIRVIDGITVRCTSVVEQIENIEDELRQKPEQLNQLSVYASKQVNDLNEMKEVLKTTVN
SRKAILQRLLDVTYFLDNCCETRKHTDTMLSNVKSSRVKLEIVQPIKDQLDSLKVEMVDM
MLDDQQKNMANEELRKTYENLKKIEMEVGRQASQKEARKAADRTEAFVGRVQNWIDNNQI
QDDTDIVSETVNLRRTTTHYQHLLSICASYKKSIDSKLEELANVYTDNDPRCLLEGIQNS
VENFEVKIHQKVDDTKKLLHITENMNELNSQNEWIRAKIKSLSAEPLWDSLLIAQKMRRR
HDNDFEEIANRRKQITEVIQKSATTKDQPILLEIEQNWDRMKDLFDERGGVLERIIKLYE
YDEESSTTSEWLREKMICADTIEPKEDESFNEVMVKKLEALTEEVENYKPRIVETHALLE
DALVTPNTKDSTSQQTMKLKAVLARKQGEIESDYKALKKLVERKLKTLKAILQDADISHQ
IADIEQWIEVEQNQLNRYLASDSDELPTKLDDVMTNIQRRRSNLTDIKCNVVGQVQMQKI
DDAFGMLDVFSFEVHRIRQKACRLEIFKKLESQTEDVIDAIQMKLEEINVSQSTSRKRQV
AGDDLSNLAGDLETLRRRVVEALDRSKEVRAANADLAPQVYDTEERLEKQWTDVSKAYEN
HKKRMERCKILSELDNEMINMEQWIDTFNEEVTVVIGSIHDGLGVQVGLESIDTWREELS
HRVDQLGGVKNSLSSVGNAITEQDKMDPWLERVSNIENNLVKARETIDTKQDDLCRFADI
LGAERDCERLYSWASGKRHQLETEATMCDAKTLVRRMNEVEKMMMSRIGEVDQLRDFLDN
LKASKTSDTFQTTELENKFELLDVEWNHLEEELRRREVDLNDSMSQILIDEQFDTIRQWI
KERTEALEADVEVSNKTKPDDIERMQKRHDELASDINDYHTIYEDFLNNGQVEEEKVQVI
RHLWSSLIESSTTRQKSLAQECQKSRLFELLDGMSIWLIDAETDVHSTTNFIGLYNSVDA
EKASRLLVSLGEQAGEKDDILIRIQCDESVDVIVEKLRNGISQLQMLIKANNEDLDVWKS
MQKVVTAIDDEICWFKEINVIFSSTNVGNDVSSNDVLKRKHQRLQLETQRREQKVAKVVY
LTTELVSSHRRPSLEYKFVEIDEKVAELTELLESNRQIAEIRTNRLEKWTEYFVTMNEIR
EKEQLLDQILDLKTGLPETVLADVERKLQVLETVGDHMDTLTIKAEQMSDDEVIRTKVAV
TAIDQLRKKWLKMNEELKKMHQKIKESIEFTKFVSTCDTGIQCIREQEEKIGNLVRHQKP
ASNFENTAYHSTMTFVETYTKDTFEKLKVVCRKLQNSTDAEKKLSLVSERLNALKKQLDL
LAEKIAVDDKFKLKVQNIQDEYSRTACELGNWLEQAEEDVSDVVWFQTKDSSEDCRETLL
EILGTLRNEKSDLLGELELLEVELAELKEDVKTFTWHSFKTLATRMERLDQTISDRIRIA
DGEISRHSDNEKICEQAACTLKTYHNVIVDVKKELEILYSLKLEDQKKSLINLIDKVQKR
GMIQDLEKWRSLMESRYIFNNKFSSATPHGVLVEMCQCLELMSSMLRSVEQSIADRNHNG
VTEKQLHEFELAFDYFDRERNGWLDYKHFELCLKSQGYNFSAENTLKETMTLLDPSTTGH
IQKHDYVRYMVKHETTNILDDHSAIEDALKNLDARKISDSMPRKEAEFFMSKIAKHAETS
SDQVYLEYKDFVNSFY
Download sequence
Identical sequences P34367
C50C3.2 NP_498787.3.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]