SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P34931 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P34931
Domain Number 1 Region: 7-189
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.81e-73
Family Actin/HSP70 0.0000000271
Further Details:      
 
Domain Number 2 Region: 193-384
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.77e-70
Family Actin/HSP70 0.0000000152
Further Details:      
 
Domain Number 3 Region: 388-545
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 5.76e-65
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.000000109
Further Details:      
 
Domain Number 4 Region: 540-619
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 4.97e-29
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P34931
Sequence length 641
Comment (sp|P34931|HS71L_HUMAN) Heat shock 70 kDa protein 1-Hom KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HSPA1L; OC=Catarrhini; Hominidae; Homo.
Sequence
MATAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEE
ISSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSIT
RARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTF
DIDANGILNVTATDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAA
KNALESYAFNMKSVVSDEGLKGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKE
LEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
Download sequence
Identical sequences A0A1U9X7W7 P34931
ENSP00000364805 ENSP00000387691 ENSP00000396486 9606.ENSP00000364805 9606.ENSP00000396486 gi|124256496|ref|NP_005518.3| NP_005518.3.87134 NP_005518.3.92137 ENSP00000364805 ENSP00000446925 ENSP00000364805 ENSP00000396486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]