SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P35056 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P35056
Domain Number 1 Region: 300-611
Classification Level Classification E-value
Superfamily TPR-like 6.96e-98
Family Tetratricopeptide repeat (TPR) 0.00000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P35056
Sequence length 612
Comment (sp|P35056|PEX5_YEAST) Peroxisomal protein PAS10 KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=YD8419.11; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MDVGSCSVGNNPLAQLHKHTQQNKSLQFNQKNNGRLNESPLQGTNKPGISEAFISNVNAI
SQENMANMQRFINGEPLIDDKRRMEIGPSSGRLPPFSNVHSLQTSANPTQIKGVNDISHW
SQEFQGSNSIQNRNADTGNSEKAWQRGSTTASSRFQYPNTMMNNYAYASMNSLSGSRLQS
PAFMNQQQSGRSKEGVNEQEQQPWTDQFEKLEKEVSENLDINDEIEKEENVSEVEQNKPE
TVEKEEGVYGDQYQSDFQEVWDSIHKDAEEVLPSELVNDDLNLGEDYLKYLGGRVNGNIE
YAFQSNNEYFNNPNAYKIGCLLMENGAKLSEAALAFEAAVKEKPDHVDAWLRLGLVQTQN
EKELNGISALEECLKLDPKNLEAMKTLAISYINEGYDMSAFTMLDKWAETKYPEIWSRIK
QQDDKFQKEKGFTHIDMNAHITKQFLQLANNLSTIDPEIQLCLGLLFYTKDDFDKTIDCF
ESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNLAVSSMNIGC
FKEAAGYLLSVLSMHEVNTNNKKGDVGSLLNTYNDTVIETLKRVFIAMNRDDLLQEVKPG
MDLKRFKGEFSF
Download sequence
Identical sequences N1PAG2 P35056
YDR244W YDR244W 4932.YDR244W NP_010530.1.97178 YDR244W YDR244W YDR244W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]