SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P35564 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P35564
Domain Number 1 Region: 61-280
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.85e-87
Family Calnexin/calreticulin 0.00000000291
Further Details:      
 
Domain Number 2 Region: 270-410
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 2.29e-59
Family P-domain of calnexin/calreticulin 0.0000000338
Further Details:      
 
Domain Number 3 Region: 412-457
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000131
Family Calnexin/calreticulin 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P35564
Sequence length 591
Comment (sp|P35564|CALX_MOUSE) Calnexin KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Canx; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MEGKWLLCLLLVLGTAAVEAHDGHDDDAIDIEDDLDDVIEEVEDSKSKSDASTPPSPKVT
YKAPVPTGEVYFADSFDRGSLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKG
LVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTAELSLDQF
HDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYT
LILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAV
KPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPK
CESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPF
SAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVLQMLEAAEE
RPWLWVVYILTVALPVFLVILFCCSGKKQSNAMEYKKTDAPQPDVKDEEGKEEEKNKRDE
EEEEEKLEEKQKSDAEEDGVTGSQDEEDSKPKAEEDEILNRSPRNRKPRRE
Download sequence
Identical sequences P35564 Q5SUC3
ENSMUSP00000020637 NP_001103969.1.92730 NP_001103970.1.92730 NP_031623.1.92730 ENSMUSP00000020637 ENSMUSP00000137440 ENSMUSP00000020637 10090.ENSMUSP00000020637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]