SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P36066 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  P36066
Domain Number - Region: 98-162
Classification Level Classification E-value
Superfamily TPR-like 0.00136
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P36066
Sequence length 463
Comment (sp|P36066|MGR3L_YEAST) Protein MRG3-like KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=YKL133C; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MWKYLHRSVKNEGTVERLTNLNLFTNHRFKFYSTLKEQSFWRIPFKRRSKLQKWVLSTGI
VSFIAFNIWWVYWPHHTFPKPVAKILRKGLHSEIKKEGANYQKSLEYYLEALEECKAENV
DLLSDEYTGIEIKIGEMYEKLHMYNDATALYGDMLKKFYNELSKTTDKSTKRKFFLLKRD
LQILVRFNEINKDSETNATLLIMHLLLAQREFLENSPEFKNVLSKSELLNNQQLDWKNFK
GLPFIGKSKPDYQMHLNSKRKQELKIKEPESEQCVFMKELLTARDLYTRYCLNRSNLSGA
LNSKITTLEWMLLADSPLDDILLAQAELGSIFYLNSEKFEGSLYAIDNEPYKKSEPLELI
RSRLQENQNSCLQYSADCYKSIISFANENQYPKVAMESEMDQRILKALSLAHYGIGVINL
HKGRLRASKKELKKAIRISEMIRFNELIEEAQRELKKVDGTPI
Download sequence
Identical sequences B3LQW7 C7GVI3 H0GJ17 N1P8C6 P36066
YKL133C SCRT_03893 YKL133C YKL133C YKL133C YKL133C YKL133C YKL133C NP_012789.2.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]