SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P37804 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P37804
Domain Number 1 Region: 17-158
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.82e-43
Family Calponin-homology domain, CH-domain 0.000000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P37804
Sequence length 201
Comment (sp|P37804|TAGL_MOUSE) Smooth muscle protein 22-alpha KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Tagln; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIVVQCGPDVGRPDRGRLGFQVWLKNGV
ILSKLVNSLYPEGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLYEG
KDMAAVQRTLMALGSLAVTKNDGNYRGDPNWFMKKAQEHKRDFTDSQLQEGKHVIGLQMG
SNRGASQAGMTGYGRPRQIIS
Download sequence
Identical sequences P37804
ENSMUSP00000034590 ENSMUSP00000034590 NP_035656.1.92730 ENSMUSP00000034590 10090.ENSMUSP00000034590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]