SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P38215 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  P38215
Domain Number - Region: 56-117
Classification Level Classification E-value
Superfamily TPR-like 0.0417
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P38215
Sequence length 129
Comment (sp|P38215|YBM3_YEAST) Putative uncharacterized protein YBR013C KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=YBR013C; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MIYPLFRICILGAFLLGSYACLENSTQKGIEGVTLSHNSVQINNTLAKSAPFCESDALSM
NYSTENMLSNNACDYTKNSSYPYIITIITKAFDNALENSLNLQANRKLYHRVGTCIQNIF
YQLLLTVNY
Download sequence
Identical sequences P38215
NP_009569.1.97178 YTYst418 YBR013C 4932.YBR013C YBR013C YBR013C YBR013C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]