SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P38349 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P38349
Domain Number 1 Region: 165-293
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.17e-18
Family UBX domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P38349
Sequence length 436
Comment (sp|P38349|UBX7_YEAST) UBX domain-containing protein 7 KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=UBX7; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MLEALFRDSVEEAINDSIKEGVVLAVYNTARDDQWLKSWFKGDDVSLDTLAEHSIWLRLV
KDTEQFQLFEQVFPNVVVPSIYLIRAGKIELIIQGEDDRHWEKLLACIGIKDKKAGESSS
RETNPGLAREEKSSRDVHRKNARERIAETTLEIQRREQLKQRKLAEEERERIIRLVRADR
AERKALDETHHRTLDDDKPLDVHDYIKDAQKLHSSKCVLQIRMTDGKTLKHEFNSSETLN
DVRKWVDVNRTDGDCPYSFHRGIPRVTFKDSDELKTLETLELTPRSALLLKPLETQNSGL
SVTGMEGPSLLGRLYKGFSTWWHNDKDPEVTSQREETSKPNRHEVRSSTPLSGAASSSCF
QYNNVREPVQSSAHASPMLTPSGTRYPSETNLTTSRSVSPNVFQFVNNDHQEDPEDPTTF
NGNNVHLEKKKDEDKK
Download sequence
Identical sequences N1P8M9 P38349
YBR273C 4932.YBR273C NP_009832.1.97178 YBR273C YBR273C YBR273C YBR273C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]