SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P38811 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P38811
Domain Number 1 Region: 3307-3480,3522-3703
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.06e-49
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.028
Further Details:      
 
Domain Number 2 Region: 10-196,325-476,733-966,995-1045
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000576
Family Armadillo repeat 0.052
Further Details:      
 
Domain Number 3 Region: 1867-1957,2068-2292
Classification Level Classification E-value
Superfamily ARM repeat 0.0000016
Family MIF4G domain-like 0.085
Further Details:      
 
Domain Number 4 Region: 744-962,1030-1109,1156-1351,1400-1567,1598-1616,1828-1917
Classification Level Classification E-value
Superfamily ARM repeat 0.0000905
Family GUN4-associated domain 0.072
Further Details:      
 
Weak hits

Sequence:  P38811
Domain Number - Region: 3019-3095
Classification Level Classification E-value
Superfamily TPR-like 0.000114
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Domain Number - Region: 2538-2658,2797-2985,3071-3260
Classification Level Classification E-value
Superfamily ARM repeat 0.000633
Family Armadillo repeat 0.073
Further Details:      
 
Domain Number - Region: 457-519
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 0.0798
Family Glutamyl tRNA-reductase dimerization domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P38811
Sequence length 3744
Comment (sp|P38811|TRA1_YEAST) p400 kDa component of SAGA KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=TRA1; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSLTEQIEQFASRFRDDDATLQSRYSTLSELYDIMELLNSPEDYHFFLQAVIPLLLNQLK
EVPISYDAHSPEQKLRNSMLDIFNRCLMNQTFQPYAMEVLEFLLSVLPKENEENGILCMK
VLTTLFKSFKSILQDKLDSFIRIIIQIYKNTPNLINQTFYEAGKAEQGDLDSPKEPQADE
LLDEFSKNDEEKDFPSKQSSTEPRFENSTSSNGLRSSMFSFKILSECPITMVTLYSSYKQ
LTSTSLPEFTPLIMNLLNIQIKQQQEAREQAESRGEHFTSISTEIINRPAYCDFILAQIK
ATSFLAYVFIRGYAPEFLQDYVNFVPDLIIRLLQDCPSELSSARKELLHATRHILSTNYK
KLFLPKLDYLFDERILIGNGFTMHETLRPLAYSTVADFIHNIRSELQLSEIEKTIKIYTG
YLLDESLALTVQIMSAKLLLNLVERILKLGKENPQEAPRAKKLLMIIIDSYMNRFKTLNR
QYDTIMKYYGRYETHKKEKAEKLKNSIQDNDKESEEFMRKVLEPSDDDHLMPQPKKEDIN
DSPDVEMTESDKVVKNDVEMFDIKNYAPILLLPTPTNDPIKDAFYLYRTLMSFLKTIIHD
LKVFNPPPNEYTVANPKLWASVSRVFSYEEVIVFKDLFHECIIGLKFFKDHNEKLSPETT
KKHFDISMPSLPVSATKDARELMDYLAFMFMQMDNATFNEIIEQELPFVYERMLEDSGLL
HVAQSFLTSEITSPNFAGILLRFLKGKLKDLGNVDFNTSNVLIRLFKLSFMSVNLFPNIN
EVVLLPHLNDLILNSLKYSTTAEEPLVYFYLIRTLFRSIGGGRFENLYRSIKPILQVLLQ
SLNQMILTARLPHERELYVELCITVPVRLSVLAPYLPFLMKPLVFALQQYPDLVSQGLRT
LELCIDNLTAEYFDPIIEPVIDDVSKALFNLLQPQPFNHAISHNVVRILGKLGGRNRQFL
KPPTDLTEKTELDIDAIADFKINGMPEDVPLSVTPGIQSALNILQSYKSDIHYRKSAYKY
LTCVLLLMTKSSAEFPTNYTELLKTAVNSIKLERIGIEKNFDLEPTVNKRDYSNQENLFL
RLLESVFYATSIKELKDDAMDLLNNLLDHFCLLQVNTTLLNKRNYNGTFNIDLKNPNFML
DSSLILDAIPFALSYYIPEVREVGVLAYKRIYEKSCLIYGEELALSHSFIPELAKQFIHL
CYDETYYNKRGGVLGIKVLIDNVKSSSVFLKKYQYNLANGLLFVLKDTQSEAPSAITDSA
EKLLIDLLSITFADVKEEDLGNKVLENTLTDIVCELSNANPKVRNACQKSLHTISNLTGI
PIVKLMDHSKQFLLSPIFAKPLRALPFTMQIGNVDAITFCLSLPNTFLTFNEELFRLLQE
SIVLADAEDESLSTNIQKTTEYSTSEQLVQLRIACIKLLAIALKNEEFATAQQGNIRIRI
LAVFFKTMLKTSPEIINTTYEALKGSLAENSKLPKELLQNGLKPLLMNLSDHQKLTVPGL
DALSKLLELLIAYFKVEIGRKLLDHLTAWCRVEVLDTLFGQDLAEQMPTKIIVSIINIFH
LLPPQADMFLNDLLLKVMLLERKLRLQLDSPFRTPLARYLNRFHNPVTEYFKKNMTLRQL
VLFMCNIVQRPEAKELAEDFEKELDNFYDFYISNIPKNQVRVVSFFTNMVDLFNTMVITN
GDEWLKKKGNMILKLKDMLNLTLKTIKENSFYIDHLQLNQSIAKFQALYLRFTELSERDQ
NPLLLDFIDFSFSNGIKASYSLKKFIFHNIIASSNKEKQNNFINDATLFVLSDKCLDARI
FVLKNVINSTLIYEVATSGSLKSYLVEDKKPKWLELLHNKIWKNSNAILAYDVLDHHDLF
RFELLQLSAIFIKADPEIIAEIKKDIIKFCWNFIKLEDTLIKQSAYLVTSYFISKFDFPI
KVVTQVFVALLRSSHVEARYLVKQSLDVLTPVLHERMNAAGTPDTWINWVKRVMVENSSS
QNNILYQFLISHPDLFFNSRDLFISNIIHHMNKITFMSNSNSDSHTLAIDLASLILYWEN
KTLEITNVNNTKTDSDGDVVMSDSKSDINPVEADTTAIIVDANNNSPISLHLREACTAFL
IRYVCASNHRAIETELGLRAINILSELISDKHWTNVNVKLVYFEKFLIFQDLDSENILYY
CMNALDVLYVFFKNKTKEWIMENLPTIQNLLEKCIKSDHHDVQEALQKVLQVIMKAIKAQ
GVSVIIEEESPGKTFIQMLTSVITQDLQETSSVTAGVTLAWVLFMNFPDNIVPLLTPLMK
TFSKLCKDHLSISQPKDAMALEEARITTKLLEKVLYILSLKVSLLGDSRRPFLSTVALLI
DHSMDQNFLRKIVNMSRSWIFNTEIFPTVKEKAAILTKMLAFEIRGEPSLSKLFYEIVLK
LFDQEHFNNTEITVRMEQPFLVGTRVEDIGIRKRFMTILDNSLERDIKERLYYVIRDQNW
EFIADYPWLNQALQLLYGSFNREKELSLKNIYCLSPPSILQEYLPENAEMVTEVNDLELS
NFVKGHIASMQGLCRIISSDFIDSLIEIFYQDPKAIHRAWVTLFPQVYKSIPKNEKYGFV
RSIITLLSKPYHTRQISSRTNVINMLLDSISKIESLELPPHLVKYLAISYNAWYQSINIL
ESIQSNTSIDNTKIIEANEDALLELYVNLQEEDMFYGLWRRRAKYTETNIGLSYEQIGLW
DKAQQLYEVAQVKARSGALPYSQSEYALWEDNWIQCAEKLQHWDVLTELAKHEGFTDLLL
ECGWRVADWNSDRDALEQSVKSVMDVPTPRRQMFKTFLALQNFAESRKGDQEVRKLCDEG
IQLSLIKWVSLPIRYTPAHKWLLHGFQQYMEFLEATQIYANLHTTTVQNLDSKAQEIKRI
LQAWRDRLPNTWDDVNMWNDLVTWRQHAFQVINNAYLPLIPALQQSNSNSNINTHAYRGY
HEIAWVINRFAHVARKHNMPDVCISQLARIYTLPNIEIQEAFLKLREQAKCHYQNMNELT
TGLDVISNTNLVYFGTVQKAEFFTLKGMFLSKLRAYEEANQAFATAVQIDLNLAKAWAQW
GFFNDRRLSEEPNNISFASNAISCYLQAAGLYKNSKIRELLCRILWLISIDDASGMLTNA
FDSFRGEIPVWYWITFIPQLLTSLSHKEANMVRHILIRIAKSYPQALHFQLRTTKEDFAV
IQRQTMAVMGDKPDTNDRNGRRQPWEYLQELNNILKTAYPLLALSLESLVAQINDRFKST
TDEDLFRLINVLLIDGTLNYNRLPFPRKNPKLPENTEKNLVKFSTTLLAPYIRPKFNADF
IDNKPDYETYIKRLRYWRRRLENKLDRASKKENLEVLCPHLSNFHHQKFEDIEIPGQYLL
NKDNNVHFIKIARFLPTVDFVRGTHSSYRRLMIRGHDGSVHSFAVQYPAVRHSRREERMF
QLYRLFNKSLSKNVETRRRSIQFNLPIAIPLSPQVRIMNDSVSFTTLHEIHNEFCKKKGF
DPDDIQDFMADKLNAAHDDALPAPDMTILKVEIFNSIQTMFVPSNVLKDHFTSLFTQFED
FWLFRKQFASQYSSFVFMSYMMMINNRTPHKIHVDKTSGNVFTLEMLPSRFPYERVKPLL
KNHDLSLPPDSPIFHNNEPVPFRLTPNIQSLIGDSALEGIFAVNLFTISRALIEPDNELN
TYLALFIRDEIISWFSNLHRPIIENPQLREMVQTNVDLIIRKVAQLGHLNSTPTVTTQFI
LDCIGSAVSPRNLARTDVNFMPWF
Download sequence
Identical sequences N1P137 P38811
YHR099W YHR099W NP_011967.1.97178 YHR099W YHR099W 4932.YHR099W YHR099W YHR099W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]