SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P40553 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P40553
Domain Number 1 Region: 61-210
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.49e-32
Family Glutathione peroxidase-like 0.000000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P40553
Sequence length 215
Comment (sp|P40553|DOT5_YEAST) Thioredoxin peroxidase KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=YIL010W OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MGEALRRSTRIAISKRMLEEEESKLAPISTPEVPKKKIKTGPKHNANQAVVQEANRSSDV
NELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACGFRDNYQE
LKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFIF
VDGKLKFKRVKISPEVSVNDAKKEVLEVAEKFKEE
Download sequence
Identical sequences N1P967 P40553
YIL010W NP_012255.3.97178 XP_015332418.1.40921 4932.YIL010W YIL010W YIL010W YIL010W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]