SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P40990 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P40990
Domain Number 1 Region: 157-337
Classification Level Classification E-value
Superfamily TPR-like 0.000000319
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Weak hits

Sequence:  P40990
Domain Number - Region: 74-154
Classification Level Classification E-value
Superfamily Prefoldin 0.0602
Family Prefoldin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P40990
Sequence length 351
Comment (sp|P40990|MSS2_YEAST) Protein MSS2, mitochondrial KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=MSS2; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MQRFVSKFVSTPPVPKKFQEIFPKKRTVNKILFQLDTRLTYHEMYPIFLQVSQNTNEENI
PWRKKYPYIRSSDIMQMRNVLITLRTQNKFVHKDLLAMEDKLLNIAAELGNNDAISILSF
NVIHEYKKENVKSSYEKDIETANEFIKKLYARNHHLTVKLIGDLFFENKTYDKAEKYYQE
FLKLENSTKLAGEVHGKLGEIQIKQVNGFLKAEKSWLSCIELLEIERSSRWYFLLARLYM
SSEPMKAKALLENCASIGFKECFKTLGFLELNYFNNYERAKEWFKTGMEIMDLECFFGFF
DCCVKEENFKGARDCLESVKKLGNDKDKKTMINVFLESRKDSIKLLDKARL
Download sequence
Identical sequences N1PA92 P40990
YDL107W NP_010176.1.97178 4932.YDL107W YDL107W YDL107W YDL107W YT389 YDL107W YDL107W YDL107W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]