SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P42842 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P42842
Domain Number 1 Region: 634-739,792-827
Classification Level Classification E-value
Superfamily TPR-like 1.39e-17
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 
Weak hits

Sequence:  P42842
Domain Number - Region: 516-603
Classification Level Classification E-value
Superfamily TPR-like 0.00569
Family Tetratricopeptide repeat (TPR) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P42842
Sequence length 904
Comment (sp|P42842|EMW1_YEAST) Essential for maintenance of the cell wall protein 1 KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=EMW1; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
METLLHAKLLLSAEVESLKSGSFDQTYVKKAEHIISGESYQLVQQFVDKFKGKISISGEI
STSSVIAALNDFLNVEVFKMGQENEMLFLAIALLQTFIQNNYTGPAARLKAISGLFGKTG
IEIGAVNTALSRSLAIMGQPAYEFMDDPLYLVLSLLLLERITGQKSLFDVTPDQEIPLPI
ISAESTPGLLAVAYWWWARALLTQLSLIPEPSGFQASVASAIYQSADLAYAITKELPESI
HEDFKRELCAMYYLENVKCSLAINTEHLCLPSLTRAKKITNFEFVMTGARATRTKYQQKA
HAGLIILAKSFTFQNFALRTTSATPETFALESDLLLEKPHFESIADEPLDEQIYSKRQKV
DLNEGYEEDKLLPLALRQENIPKLLLDLNPNDQPTLSDYDNIQLLLRLYTIKNTTPAKDP
LVEEELTALLSRILYQNGDKNWSIFARSLWERSIIETTKAKTIERGLLQMQSLVEELDLK
IKSKLVPSSSEINVASRLSYIHQLPFIPRWQLDATLAEKYMSLGILKSAVEIYERLGMAC
ETALCYAAVGDEKKAEEILLQRINENDSDARAYSILGDIKQDPSLWEKSWEIGKYVNAKN
SLAKYYFNPPPKSGAQPNYSATLKHLNDSLRQYPLSFETWYFYGCVGLQCGKMQIAAEAF
TRCVSLDPYHALSWSNLSAAYTKMDKLKEAYSCLKRAISCDAQKNWKIWENYMLVAVKLN
EWEDVLTACKQLVSIRRDKSGEGSIDLPIIEKLVELLVTSEYPEEPQQLSYFQKSCTEFI
CNTLPQVITTSARCWRLVARVELWRKRPWAALECHEKAYRAISHNPDLEVEEKVWNDTVD
ACEDLVAAYESLGEMEGKYGPGSLVCKDWKYKCRSTIKALMSKGKGRWDDSPGWDRLVEA
RSQI
Download sequence
Identical sequences N1NXU2 P42842
YR283 YNL313C YNL313C YNL313C YNL313C NP_014086.1.97178 4932.YNL313C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]