SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P47133 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P47133
Domain Number 1 Region: 87-123,152-257
Classification Level Classification E-value
Superfamily TPR-like 0.00000000835
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P47133
Sequence length 292
Comment (sp|P47133|EMC2_YEAST) ER membrane protein complex subunit 2 KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=EMC2; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MLKDLVREKLLTIMNTKAYTQFNPEQLLQLENEMKIYMKSGDSALTEGNYFFLMEMLFYV
LVYRNQDVDAQVVYNTLRDRLGENSYKMVIMKATLLQINGNDKGAIEYLENLLNDDLEYE
TDFVTYVSIAKKLIAIKTTSKNLSQESVLKEVVALTDKFPLDAELWWYASEIYFEMGQFE
KACYCLEQVLCITPFNYACFGRLSETLYYEALRSKKQTKTELLEKALKNALRSVELSELY
LKGWALVNIISRELGRNKQNDLIKLSASKLKEISAKSNNKDKITAELILNKI
Download sequence
Identical sequences P47133
YJR088C YJR088C NP_012621.1.97178 YJR088C 355048 YJR088C YJR088C 4932.YJR088C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]