SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P47791 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P47791
Domain Number 1 Region: 35-377
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.84e-51
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000723
Further Details:      
 
Domain Number 2 Region: 386-499
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.17e-36
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000663
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P47791
Sequence length 500
Comment (sp|P47791|GSHR_MOUSE) Glutathione reductase, mitochondrial KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Gsr; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MALLPRALGVGAAPSLRRAARALTCAMASPGEPQPPAPDTSSFDYLVIGGGSGGLASARR
AAELGARAAVVESHKLGGTCVNVGCVPKKVMWNTAVHSEFMHDHVDYGFQSCEGKFSWHV
IKQKRDAYVSRLNTIYQNNLTKSHIEIIHGYATFADGPRPTVEVNGKKFTAPHILIATGG
VPTVPHESQIPGASLGITSDGFFQLEDLPSRSVIVGAGYIAVEIAGILSALGSKTSLMIR
HDKVLRNFDSLISSNCTEELENAGVEVLKFTQVKEVKKTSSGLELQVVTSVPGRKPTTTM
IPDVDCLLWAIGRDPNSKGLNLNKVGIQTDEKGHILVDEFQNTNVKGVYAVGDVCGKALL
TPVAIAAGRKLAHRLFECKQDSKLDYDNIPTVVFSHPPIGTVGLTEDEAVHKYGKDNVKI
YSTAFTPMYHAVTTRKTKCVMKMVCANKEEKVVGIHMQGIGCDEMLQGFAVAVKMGATKA
DFDNTVAIHPTSSEELVTLR
Download sequence
Identical sequences P47791
10090.ENSMUSP00000033992 NP_034474.4.92730 ENSMUSP00000033992 ENSMUSP00000033992 ENSMUSP00000033992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]