SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P49222 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P49222
Domain Number 1 Region: 145-458
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.29e-84
Family Transglutaminase core 0.000000797
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 2.38e-39
Family Transglutaminase N-terminal domain 0.00016
Further Details:      
 
Domain Number 3 Region: 472-585
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.14e-27
Family Transglutaminase, two C-terminal domains 0.0039
Further Details:      
 
Domain Number 4 Region: 587-685
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.76e-27
Family Transglutaminase, two C-terminal domains 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P49222
Sequence length 691
Comment (sp|P49222|EPB42_MOUSE) Erythrocyte membrane protein band 4.2 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Epb42; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MGQALSIKSCDFHAAENNEEHYTKAISSQHLTLRRGQSFTITLNFRAPTHTFLSALKKVA
LIAQTGEQPSKINKTQAIFPISSLGDQKGWSAAVEERDAQHWTVSVTTPVDAVIGHYSLL
LQVSGKKQYPLGQFTLLFNPWNRDDAVFLQNEAERTEYVLNQNGFIYLGTADCIQEEPWD
FGQFEKDVMDLSLKLLSMDKQVKDWNQPAHVARVVGALLHALKKKSVLPISQTQAAQEGA
LLYKRRGSVPILRQWLTGQGRAVYETQAWVSAAVACTVLRCLGIPARVVTTFDSAQGTVG
SLLVDEYYNEEGLQNGEGQRGHIWVFQTSVECWMNRPDLSQGYGGWQILHPRAPNGAGVL
GSCSLVPVRAVKEGELQLDPAVPELFAAVNASCVVWKCCEDGKLELTNSNRKDVGNCIST
KVVGSDRCEDITQNYKYPAGSLQEKEVLEKVQKERLKLGKDNGMCPPSCEPWDPLHMFFE
ASSSIPLSGDGQLSVTLINPTDEEKKVHLVIGAQALYYNGVLAAGLWSKKQLFMLKPNQV
MRLSTNLSFSCFEQTPPENSFLRVTAMARYSHTSLSCFAQENMAIGKPDLIIEMPKRAAQ
YRPLTVSVRMHNSLEAPMQNCIISIFGRGLIHREKRYGLGSLWPGSSLHTQFQFTPTHLG
LQRLTVEVDCDMFQNLTGYRSVLVVAPEVSV
Download sequence
Identical sequences P49222
ENSMUSP00000099548 10090.ENSMUSP00000099548 NYSGRC-IgSF-P49222 NP_038541.1.92730 ENSMUSP00000099548 ENSMUSP00000023987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]