SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P50534 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P50534
Domain Number 1 Region: 20-96
Classification Level Classification E-value
Superfamily RING/U-box 0.0000165
Family RING finger domain, C3HC4 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P50534
Sequence length 773
Comment (sp|P50534|MSL2_DROME) Protein male-specific lethal-2 KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=msl-2; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MAQTAYLKVTRIAMRSASNLSKRRVEELNSGLGELRQLLSCVVCCQLLVDPYSPKGKRCQ
HNVCRLCLRGKKHLFPSCTQCEGCSDFKTYEENRMMAAQLLCYKTLCVHLLHSALFGELA
GMRPQVARELVPRIKLPPKTTQEFIREGSNISDTFDIFLPQPDLPFLKDMPTSLPAETPP
TSAVTTPELPYDHHLNISDIEAEAAATAEQGHFSPLPLLPTGSRMGMLSHAGQIVIATES
SESGFMDQAWTDQVDLSGTVSVSKYTNSGNNFAVSYVMPTSATTKFDPQELQIGQVVQMA
DSTQLAVLAAVEETVETSTQLTVLSTTVEETVETSTQLEVLTSAEEPNEISDQLANLQVE
ESDEALVEETVEEAEGTSIPSEVVAEHMEEDQHLDVHTSQSPTQTEMEEAVEEHVATKTQ
LGHVQTELQDAESLQKDFEDAKAAAEEAKEKEKDLHAISAELQKEDSDEPTLKRKRTRTL
KASQAAKIEPVPSEVKTKVQSGKGALRRIRGKDKEEKVKPPKPKCRCGISGSSNTLTTCR
NSRCPCYKSYNSCAGCHCVCCKNPHKEDYVESDEDDDLEDFEMPKDVPEPMTQSEEPVVA
EPRQEENSMAPPDSSAPISLVPLNNLQQSQHPLVLVQNEKGEYQGFNIFQGSKPLDPVTV
GFTIRVQLQHTDGFGSLPQYAYIMPTIDPPNPPAPSLSPPPPPAPDREVIEPPAKKFRTS
RTRRGRANFSALDTVDELVSGGSRSNSAAGDRSSATDNAHSLFEEIMSGSDDL
Download sequence
Identical sequences A4V038 P50534
FBpp0077259 FBpp0077260 NP_523467.1.81976 NP_722907.1.81976 FBpp0077259 7227.FBpp0077259 FBpp0077259 FBpp0077260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]