SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P51815 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P51815
Domain Number 1 Region: 42-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.66e-34
Family SCAN domain 0.000079
Further Details:      
 
Domain Number 2 Region: 402-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.03e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 443-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.94e-20
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 4 Region: 360-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-19
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 233-278
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-17
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P51815
Sequence length 510
Comment (sp|P51815|ZN75D_HUMAN) Zinc finger protein 82 KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ZNF75D; OC=Catarrhini; Hominidae; Homo.
Sequence
MAMRELNADSCSSPQMGAMWETSGSVKENSSQSKKYSTKIENLGPESACRHFWSFRYHEA
TGPLETISQLQKLCHQWLRPEIHSKEQILEMLVLEQFLSILPKETQNWVQKHHPQNVKQA
LVLVEFLQREPDGTKNEVTAHELGKEAVLLGGTAVAPGFKWKPAEPQPMGVFQKEYWNTY
RVLQEQLGWNTHKETQPVYERAVHDQQMLALSEQKRIKHWKMASKLILPESLSLLTFEDV
AVYFSEEEWQLLNPLEKTLYNDVMQDIYETVISLGLKLKNDTGNDHPISVSTSEIQTSGC
EVSKKTRMKIAQKTMGRENPGDTHSVQKWHRAFPRKKRKKPATCKQELPKLMDLHGKGPT
GEKPFKCQECGKSFRVSSDLIKHHRIHTGEKPYKCQQCDRRFRWSSDLNKHFMTHQGIKP
YRCSWCGKSFSHNTNLHTHQRIHTGEKPFKCDECGKRFIQNSHLIKHQRTHTGEQPYTCS
LCKRNFSRRSSLLRHQKLHRRREACLVSPN
Download sequence
Identical sequences P51815
9606.ENSP00000359802 gi|41152070|ref|NP_009062.2| ENSP00000359800 ENSP00000359802 ENSP00000471278 ENSP00000359802 NP_009062.2.87134 NP_009062.2.92137 XP_005262526.1.92137 XP_011529693.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]