SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P52633 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P52633
Domain Number 1 Region: 265-528
Classification Level Classification E-value
Superfamily p53-like transcription factors 4.14e-81
Family STAT DNA-binding domain 0.00038
Further Details:      
 
Domain Number 2 Region: 529-648
Classification Level Classification E-value
Superfamily SH2 domain 4.98e-35
Family SH2 domain 0.00026
Further Details:      
 
Domain Number 3 Region: 114-273
Classification Level Classification E-value
Superfamily STAT 1.18e-26
Family STAT 0.0028
Further Details:      
 
Domain Number 4 Region: 1-114
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 2.22e-25
Family Transcription factor STAT-4 N-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P52633
Sequence length 837
Comment (sp|P52633|STAT6_MOUSE) Signal transducer and transcription activator 6 KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Stat6; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MSLWGLISKMSPEKLQRLYVDFPQRLRHLLADWLESQPWEFLVGSDAFCYNMASALLSAT
VQRLQATAGEQGKGNSILPHISTLESIYQRDPLKLVATIRQILQGEKKAVIEEFRHLPGP
FHRKQEELKFTTALGRLQHRVRETRLLRESLQQGAKTGQVSLQNLIDPPVNGPGPSEDLA
TMLQGTVGDLEATQALVLKRIQIWKRQQQLAGNGTPFEESLAGLQERCESLVEIYSQLQQ
EIGAASGELEPKTRASLISRLDEVLRTLVTSSFLVEKQPPQVLKTQTKFQAGVRFLLGLQ
FLGTSAKPPMVRADMVTEKQARELSLAQGPGTGVESTGEIMNNTVPLENSIPSNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSTSFTLGPNKLLIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTSRGLLPEHFLFLAQK
IFNDNSLSVEAFQHRCVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSSQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVSTTIKMTVERDQPLPTPE
PQMPAMVPPYDLGMAPDASMQLSSDMGYPPQSIHSFQSLEESMSVLPSFQEPHLQMPPNM
SQITMPFDQPHPQGLLQCQSQEHAVSSPEPMLCSDVTMVEDSCLTQPVGGFPQGTWVSED
MYPPLMPPTEQDLTKLLLENQGEAGGSLGSQPLLQPSPYGQSGISLSHLDLRTNPSW
Download sequence
Identical sequences P52633
NP_033310.2.92730 ENSMUSP00000089708 ENSMUSP00000089708 10090.ENSMUSP00000089708 ENSMUSP00000089708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]