SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P53691 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P53691
Domain Number 1 Region: 2-181
Classification Level Classification E-value
Superfamily Cyclophilin-like 4.38e-70
Family Cyclophilin (peptidylprolyl isomerase) 0.00000127
Further Details:      
 
Domain Number 2 Region: 217-363
Classification Level Classification E-value
Superfamily TPR-like 2.8e-19
Family Tetratricopeptide repeat (TPR) 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P53691
Sequence length 371
Comment (sp|P53691|PPID_YEAST) Rotamase CPR6 KW=Complete proteome; Reference proteome OX=559292 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). GN=CPR6; OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MTRPKTFFDISIGGKPQGRIVFELYNDIVPKTAENFLKLCEGNAGMAKTKPDVPLSYKGS
IFHRVIKDFMCQFGDFTNFNGTGGESIYDEKFEDENFTVKHDKPFLLSMANAGPNTNGSQ
AFITCVPTPHLDGKHVVFGEVIQGKRIVRLIENQQCDQENNKPLRDVKIDDCGVLPDDYQ
VPENAEATPTDEYGDNYEDVLKQDEKVDLKNFDTVLKAIETVKNIGTEQFKKQNYSVALE
KYVKCDKFLKEYFPEDLEKEQIEKINQLKVSIPLNIAICALKLKDYKQVLVASSEVLYAE
AADEKAKAKALYRRGLAYYHVNDTDMALNDLEMATTFQPNDAAILKAIHNTKLKRKQQNE
KAKKSLSKMFS
Download sequence
Identical sequences P53691
NP_013317.1.97178 YLR216C YLR216C 4932.YLR216C YLR216C YLR216C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]