SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P55314 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P55314
Domain Number 1 Region: 543-589
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000249
Family TSP-1 type 1 repeat 0.00059
Further Details:      
 
Domain Number 2 Region: 123-163
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 63-111
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000615
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 4 Region: 498-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000591
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P55314
Sequence length 589
Comment (sp|P55314|CO8B_RAT) Complement component 8 subunit beta KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=C8b; OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MKTGAQVWRALAKSCLLCAALGCLHLPGARGEKPDFFETNAVNGSLVRSRPVRSVDVTPA
PTDCQLSTWSSWTACDPCQKKRYRHTYLLRPSQFYGELCDFSDKEVEDCVTNRACRSQVR
CEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCSQDMEQYWAIGNLASGINL
FTNTFEGPVLDHRYYAGACSPHYILNTNFRKPYNVESYTPQTQGKYEFALTEYESYFDFE
HNVTEKATSKSSFKFGFKLDGLVEFGVRKESNEGRHYISRTKRFSHTKSKFLHARSVLEV
AHYKLKSRQLMLHYEFLQRVKSLPLEYSYGEYRDLLRDFGTHFITEAVLGGIYEYTLIMN
KDAMERGDYTLDHVSACAGGGFQIGGNVYKVYLKLGVSEKKCSDILNEIKDRNKRRTMVE
DLVVLVRGGTSEYITSLAYKDLPTAELMKEWGDAVQYNPAIIKLKAEPLYELVTATDFAY
SSTVKQNMKKALEEFQMEVSSCRCAPCRNNGVPILKESRCECICPAGFQGVACEVTNRKD
IPIDGKWSCWSDWSPCSGGRKTRQRQCNNPAPQRGGSPCSGPASETLDC
Download sequence
Identical sequences P55314
NP_001178688.1.100692 NP_001178688.1.4139 XP_006238557.1.100692 ENSRNOP00000010100 10116.ENSRNOP00000010100 ENSRNOP00000010100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]