SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P56722 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P56722
Domain Number 1 Region: 678-974
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.86e-91
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P56722
Sequence length 979
Comment (sp|P56722|PTPRN_BOVIN) ICA512-cleaved cytosolic fragment KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=PTPRN; OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MRLPGRPGGPGGSGGLRVLLCLLLLGSRPGGCNAISAHGCLFDRRLCSHLEVCIQDGLFG
QCQVGVGQARPLLQVTSPVLQRLQGVLRQLMSQGLSWHDDLTQYVISQEMERIPRLRPPE
PHPRDRSGLVPRRPGPAGELLLQGIPTGSAPALQHRLPRPSVGGGRAGAGSPLSPLQAEL
LPPLLEHLLLPPQPPHPALSYEPALLQPYLFHQFGSRDGSRGSESSPGMVSVDPLPKAEA
PAFLSRAGSKGMFGAHPGHSYGDPPGPPPAQLFQESELFYLAQESQVPSRTRAPRLPEPG
GSSRAGDSSEGYEEEGLEGREEKPPAPAEQPDVTLQRVAAVLAGYGVELHQLTPEQLSTL
STLLQLLPKGSRQNPGGAVNVGADIKKTMEEQVQGEDPAEPPPPMPSLPGSPTGSSTSNK
AQKELSTGASEPPKAAGPPATPVLVEKKSPLGQNQPTMAGQPSTRPSAEEYGYIVTDQKP
LSLAAGVRLLEILAEHVHMSSGSFINISVVGPALTFRIRHNEQNLSLADVTQQAGLVKSE
LEAQTGLQILQTGVGQREEAAAILPRPAHSTSPMRSVLLTLVALAGVAGLLVALAVALCV
RQHARQRDKERLAALGPEGAHGDTTFEYQDLCRQHMATKSLFNRAEGPPEPSRVSSVSSQ
FSDAAQASPSSHSSTPSWCEEPAQANMDISTGHMILAYMEDHLRNRDRLAKEWQALCAYQ
AEPNTCATAQGEGNIKKNRHPDFLPYDHARIKLKVESSPSRSDYINASPIIEHDPRMPAY
IATQGPLSHTIADFWQMVWESGCTVIVMLTPLVEDGVKQCDRYWPDEGSSLYHVYEVNLV
SEHIWCEDFLVRSFYLKNVQTQETRTLTQFHFLSWPAEGTPASTRPLLDFRRKVNKCYRG
RSCPIIVHCSDGAGRTGTYILIDMVLNRMAKGVKEIDIAATLEHVRDQRPGLVRSKDQFE
FALTAVAEEVNAILKALPQ
Download sequence
Identical sequences P56722
ENSBTAP00000018336 ENSBTAP00000018336 NP_001068599.1.59421 NP_001068599.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]