SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P59047 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P59047
Domain Number 1 Region: 826-1180
Classification Level Classification E-value
Superfamily RNI-like 8.73e-80
Family 28-residue LRR 0.00000487
Further Details:      
 
Domain Number 2 Region: 59-147
Classification Level Classification E-value
Superfamily DEATH domain 7.3e-25
Family Pyrin domain, PYD 0.018
Further Details:      
 
Domain Number 3 Region: 278-449
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000128
Family G proteins 0.071
Further Details:      
 
Domain Number 4 Region: 771-847
Classification Level Classification E-value
Superfamily RNI-like 0.00000073
Family 28-residue LRR 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P59047
Sequence length 1200
Comment (sp|P59047|NALP5_HUMAN) Mater protein homolog KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NLRP5; OC=Catarrhini; Hominidae; Homo.
Sequence
MKVAGGLELGAAALLSASPRALVTLSTGPTCSILPKNPLFPQNLSSQPCIKMEGDKSLTF
SSYGLQWCLYELDKEEFQTFKELLKKKSSESTTCSIPQFEIENANVECLALLLHEYYGAS
LAWATSISIFENMNLRTLSEKARDDMKRHSPEDPEATMTDQGPSKEKVPGISQAVQQDSA
TAAETKEQEISQAMEQEGATAAETEEQEISQAMEQEGATAAETEEQGHGGDTWDYKSHVM
TKFAEEEDVRRSFENTAADWPEMQTLAGAFDSDRWGFRPRTVVLHGKSGIGKSALARRIV
LCWAQGGLYQGMFSYVFFLPVREMQRKKESSVTEFISREWPDSQAPVTEIMSRPERLLFI
IDGFDDLGSVLNNDTKLCKDWAEKQPPFTLIRSLLRKVLLPESFLIVTVRDVGTEKLKSE
VVSPRYLLVRGISGEQRIHLLLERGIGEHQKTQGLRAIMNNRELLDQCQVPAVGSLICVA
LQLQDVVGESVAPFNQTLTGLHAAFVFHQLTPRGVVRRCLNLEERVVLKRFCRMAVEGVW
NRKSVFDGDDLMVQGLGESELRALFHMNILLPDSHCEEYYTFFHLSLQDFCAALYYVLEG
LEIEPALCPLYVEKTKRSMELKQAGFHIHSLWMKRFLFGLVSEDVRRPLEVLLGCPVPLG
VKQKLLHWVSLLGQQPNATTPGDTLDAFHCLFETQDKEFVRLALNSFQEVWLPINQNLDL
IASSFCLQHCPYLRKIRVDVKGIFPRDESAEACPVVPLWMRDKTLIEEQWEDFCSMLGTH
PHLRQLDLGSSILTERAMKTLCAKLRHPTCKIQTLMFRNAQITPGVQHLWRIVMANRNLR
SLNLGGTHLKEEDVRMACEALKHPKCLLESLRLDCCGLTHACYLKISQILTTSPSLKSLS
LAGNKVTDQGVMPLSDALRVSQCALQKLILEDCGITATGCQSLASALVSNRSLTHLCLSN
NSLGNEGVNLLCRSMRLPHCSLQRLMLNQCHLDTAGCGFLALALMGNSWLTHLSLSMNPV
EDNGVKLLCEVMREPSCHLQDLELVKCHLTAACCESLSCVISRSRHLKSLDLTDNALGDG
GVAALCEGLKQKNSVLARLGLKACGLTSDCCEALSLALSCNRHLTSLNLVQNNFSPKGMM
KLCSAFACPTSNLQIIGLWKWQYPVQIRKLLEEVQLLKPRVVIDGSWHSFDEDDRYWWKN
Download sequence
Identical sequences P59047
NP_703148.4.87134 NP_703148.4.92137 9606.ENSP00000375063 ENSP00000375063 gi|158321897|ref|NP_703148.4| ENSP00000375063 ENSP00000375063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]