SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for P62341 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P62341
Domain Number 1 Region: 38-78,145-187
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.68e-19
Family Selenoprotein W-related 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P62341
Sequence length 195
Comment (sp|P62341|SELT_HUMAN) Thioredoxin reductase-like selenoprotein T {ECO:0000305} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=UNQ150/PRO176 OC=Catarrhini; Hominidae; Homo.
Sequence
MRLLLLLLVAASAMVRSEASANLGGVPSKRLKMQYATGPLLKFQICVSUGYRRVFEEYMR
VISQRYPDIRIEGENYLPQPIYRHIASFLSVFKLVLIGLIIVGKDPFAFFGMQAPSIWQW
GQENKVYACMMVFFLSNMIENQCMSTGAFEITLNDVPVWSKLESGHLPSMQQLVQILDNE
MKLNVHMDSIPHHRS
Download sequence
Identical sequences P62341
ENSGGOP00000019433 ENSGGOP00000019433 ENSP00000417762 NP_001152886.1.72884 NP_001186922.1.23681 NP_057359.2.87134 NP_057359.2.92137 XP_003256333.2.23891 XP_005546147.2.63531 XP_008950120.2.60992 XP_012366165.1.23891 XP_012366166.1.23891 XP_016797645.1.37143 XP_017710412.1.44346 XP_018878984.1.27298 ENSP00000418910 ENSP00000418910 gi|42789380|ref|NP_057359.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]