SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P63034 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P63034
Domain Number 1 Region: 58-251
Classification Level Classification E-value
Superfamily Sec7 domain 8.63e-79
Family Sec7 domain 0.00000000527
Further Details:      
 
Domain Number 2 Region: 260-375
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-34
Family Pleckstrin-homology domain (PH domain) 0.000000718
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P63034
Sequence length 400
Comment (sp|P63034|CYH2_MOUSE) SEC7 homolog B KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Cyth2; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQ
RNRKMAMGRKKFNMDPKKGIQFLVEHELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREE
LNLSVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQ
STDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEDLLRNLYDSIRN
EPFKIPEDDGNDLTHTFFNPDREGWLLKLAGGRVKTWKRRWFILTDNCLYYFEYTTDKEP
RGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPT
QEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
Download sequence
Identical sequences F1LSU6 P63034
ENSMUSP00000051423 ENSRNOP00000028588 10116.ENSRNOP00000028588 ENSRNOP00000028588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]