SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P70315 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P70315
Domain Number 1 Region: 37-150
Classification Level Classification E-value
Superfamily PH domain-like 2e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.000048
Further Details:      
 
Domain Number 2 Region: 244-321
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 6.28e-31
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 447-508
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000222
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) P70315
Sequence length 520
Comment (sp|P70315|WASP_MOUSE) Wiskott-Aldrich syndrome protein homolog KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Was; OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MNSGPGPVGGRPGGRGGPAVQQNIPSNLLQDHENQRLFELLGRKCWTLATTVVQLYLALP
PGAEHWTMEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYLTPTPFFHTFA
GDDCQVGLNFADESEAQAFRALVQEKIQKRNQRQSGERRQLPPPPAPINEERRGGLPPVP
PHPGGDHGGPSGGPLSLGLVTVDIQNPDITSSRYRGLPAPGPGPTDKKRSGKKKISKADI
GAPSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQG
GLEAVRQEMRRQEPLPPPPPPCRGGGGGGGGGGGGGGGGGGQPLRPPVVGSNKGRSGPLP
PVPMGGAPPPPTPRGPPPPGRGGPPPPPPPATGRSGPPPPPLPGAGGPPAPPPPPPPPPP
PPCPGSGPAPPPLPPTPVSGGSPAPGGGRGALLDQIRQGIQLNKTPGALENSVQQPPAQQ
SEGLVGALMHVMQKRSRVIHSSDEGEDQTGEDEEDDEWDD
Download sequence
Identical sequences P70315 Q53WY0
NP_033541.1.92730 ENSMUSP00000033505 ENSMUSP00000033505 10090.ENSMUSP00000033505 ENSMUSP00000033505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]