SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P72851 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P72851
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily L28p-like 2.35e-26
Family Ribosomal protein L28 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P72851
Sequence length 78
Comment (sp|P72851|RL28_SYNY3) 50S ribosomal protein L28 KW=Complete proteome; Reference proteome OX=1111708 OS=Synechocystis sp. (strain PCC 6803 / Kazusa). GN=rpmB; OC=Synechocystis.
Sequence
MARRCQLTGKKANNGFAVSHSHRRTKKLQQANLQWKRVWWPEGNRFVRLRLSTTAIKTLE
SKGINAMAKEAGINLNKF
Download sequence
Identical sequences A0A068MWV4 L8AGF0 P72851
1148.ssr1604 gi|383324369|ref|YP_005385222.1| gi|16329458|ref|NP_440186.1| gi|383490253|ref|YP_005407929.1| gi|16329458|ref|NP_440186.1| gi|383321199|ref|YP_005382052.1| WP_010871496.1.11876 WP_010871496.1.1889 WP_010871496.1.18904 WP_010871496.1.33690 WP_010871496.1.35395 WP_010871496.1.47586 WP_010871496.1.709 WP_010871496.1.99424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]