SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P74654 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P74654
Domain Number 1 Region: 32-223,324-414
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.71e-87
Family Bacterial dinuclear zinc exopeptidases 0.0000218
Further Details:      
 
Domain Number 2 Region: 207-325
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 4.45e-31
Family Bacterial exopeptidase dimerisation domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P74654
Sequence length 416
Comment (tr|P74654|P74654_SYNY3) N-acyl-L-amino acid amidohydrolase {ECO:0000313|EMBL:BAA18770.1} KW=Complete proteome; Reference proteome OX=1111708 OS=Synechocystis sp. (strain PCC 6803 / Kazusa). GN=ama OC=Synechocystis.
Sequence
MVKMQIPSCFSTMVFTLPQPTNLPSTNVRLPIQALHGQLIQWRRQFHQYPELGFQEQLTA
AHIAETLTKLEIPHTPGIAKTGIMATVDSGKPGPVLAIRADMDALPVTEENEVDYRSLHP
GKMHACGHDGHTAIALGTAQYLAAHRDSFRGQVKFFFQPAEEGPGGAKPMIEAGVLENPA
VDAIVGLHLWNDLPVGTVGIKPGPVMAAVEHFECQLFGQGGHGAMPHQTVDTLVISAQIV
MALQGIVARNLNPLQSAVVTVGQLQSGTAFNVIPDSAYFRGTVRYFDPSFAGYFAQRIEE
IIKGICQSHGANYQFTYENIYPPVVNDRRLADLVRSAAADVLLTDDHLQPDYQTLAGEDM
SFFLQAVPGCYFFLGSANGDLGLAYPHHHPRFNFDEAVLPVGVELFVRCVERFCNA
Download sequence
Identical sequences L8AMZ5 P74654
gi|16332230|ref|NP_442958.1| gi|16332230|ref|NP_442958.1| 1148.slr1653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]