SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P82675 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P82675
Domain Number 1 Region: 175-376
Classification Level Classification E-value
Superfamily PDB 7.17e-74
Family PDB 0.00034
Further Details:      
 
Domain Number 2 Region: 288-367
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.86e-20
Family Translational machinery components 0.0038
Further Details:      
 
Domain Number 3 Region: 214-285
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000000000305
Family Ribosomal S5 protein, N-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P82675
Sequence length 430
Comment (sp|P82675|RT05_HUMAN) Mitochondrial small ribosomal subunit protein uS5m {ECO:0000303|PubMed:25838379} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MRPS5; OC=Catarrhini; Hominidae; Homo.
Sequence
MATAVRAVGCLPVLCSGTAGHLLGRQCSLNTLPAASILAWKSVLGNGHLSSLGTRDTHPY
ASLSRALQTQCCISSPSHLMSQQYRPYSFFTKLTADELWKGALAETGAGAKKGRGKRTKK
KKRKDLNRGQIIGEGRYGFLWPGLNVPLMKNGAVQTIAQRSKEEQEKVEADMIQQREEWD
RKKKMKVKRERGWSGNSWGGISLGPPDPGPCGETYEDFDTRILEVRNVFTMTAKEGRKKS
IRVLVAVGNGKGAAGFSIGKATDRMDAFRKAKNRAVHHLHYIERYEDHTIFHDISLRFKR
THIKMKKQPKGYGLRCHRAIITICRLIGIKDMYAKVSGSINMLSLTQGLFRGLSRQETHQ
QLADKKGLHVVEIREECGPLPIVVASPRGPLRKDPEPEDEVPDVKLDWEDVKTAQGMKRS
VWSNLKRAAT
Download sequence
Identical sequences P82675
NP_114108.1.87134 NP_114108.1.92137 ENSP00000272418 ENSP00000272418 gi|13994259|ref|NP_114108.1| 9606.ENSP00000272418 3j9m_AD ENSP00000272418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]