SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P83094 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P83094
Domain Number 1 Region: 202-283
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000082
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 
Weak hits

Sequence:  P83094
Domain Number - Region: 102-208
Classification Level Classification E-value
Superfamily EF-hand 0.000102
Family Calmodulin-like 0.031
Further Details:      
 
Domain Number - Region: 439-545
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.00863
Family DNA repair protein MutS, domain III 0.048
Further Details:      
 
Domain Number - Region: 199-443
Classification Level Classification E-value
Superfamily TPR-like 0.0493
Family HAT/Suf repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) P83094
Sequence length 570
Comment (sp|P83094|STIM_DROME) Stromal interaction molecule homolog KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=Stim; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence
MRKNTIWNYSLIFFCCVLKSISTLDHGPHTVSVDSNRHNTQHQYKQNPNVASQRHSSHES
GQSLHNSQSEHVTHIAASHAGSGGEHSTHLAQNLHRSSYNLLSEAMSQAVSNEFSSMGSG
SADGACAADDFDCYSGSVQDRFGMEAIASLHRQLDDDDNGNIDLSESDDFLREELKYDSG
YEKRQKAFHFNDDMHISVKELWEAWLRSEVHNWTIEQTTDWLAQSVQLPQYVDLFKLHKV
TGAALPRLAVNNLQYVGNVLGIKDPIHKQKISLKAMDVVLFGPPRETGTRWKDYILVTLL
LSAIIGCWYAYQQNKNAKRHLRRMAQDMEGLQRAEQSLQEMQKELERARMEQENVATEKL
DLERRLKEAPTLSSSNSDLEVQQLKKEIEMLRNELSRAEFELVDNCWSPPPQLQSWLQYT
YELESKNHQKKRTSAEKQLQSAREACEKLRKKRSSLVGAFVSTHGKSIDDVDRSIVEARN
ALGDVTNELQERLHRWKQIETCLGLNIVNNNGLPYLENVLYGRNGGLQSSMGMSSTKGSR
ARITNSTEDLDDESIQGKLNFENFSLLATE
Download sequence
Identical sequences P83094
FBpp0073955 7227.FBpp0073955 FBpp0073955 FBpp0073955 NP_523357.2.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]