SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for P87057 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  P87057
Domain Number 1 Region: 8-88
Classification Level Classification E-value
Superfamily HMG-box 9.69e-28
Family HMG-box 0.0000791
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) P87057
Sequence length 108
Comment (sp|P87057|NHP6_SCHPO) Non-histone chromosomal protein 6 KW=Complete proteome; Reference proteome OX=284812 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). GN=nhp6; OC=Schizosaccharomycetaceae; Schizosaccharomyces.
Sequence
MPRAAKSSRKKDPNTPKRNMSAFMFFSIENREKMKTDNPDATFGQLGSLLGKRWKELTST
EREPYEEKARQDKERYERERKEYDTKLANGEKTGKASAPAAAAAAKEE
Download sequence
Identical sequences P87057
SPAC57A10_09c.1 SPAC57A10.09c 4896.SPAC57A10.09c-1 NP_593314.1.19918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]